Rabbit Anti-CMTR2 Antibody 478239 from United States Biological | Biocompare.com

Supplier Images

Rabbit Anti-CMTR2 Antibody

Western Blot analysis NCI-H226 cell lysate using 478239 Titration: 0.2-1ug/ml

Be the first to write a review!

Supplier Page from
United States Biological for
Rabbit Anti-CMTR2 Antibody

The Rabbit Anti-CMTR2 Antibody from United States Biological is a Rabbit Polyclonal antibody to CMTR2. This antibody recognizes Homo Sapiens, and Human antigen. The Rabbit Anti-CMTR2 Antibody has been validated for the following applications: Western Blot.

Product Specs
ItemRabbit Anti-CMTR2 Antibody
CompanyUnited States Biological
Price Pricing Info Supplier Page View Company Product Page
Catalog Number478239
Antibody TypePrimary
ReactivityHu
FormatSupplied as a liquid in PBS, 2% sucrose, 0.09% sodium azide
ApplicationsWB
ImmunogenSynthetic peptide located within the following region: TKWFGQRNKYFKTYNERKMLEALSWKDKVAKGYFNSWAEEHGVYHPGQSS of human FTSJD1. Species sequence homology: bovine, canine, guinea pig, equine, mouse, rabbit, rat, yeast
TargetCMTR2
Hostrabbit
Concentration~0.5mg/ml
Quantity100ul
PurityPurified by affinity chromatography
Conjugate/TagUnconjugated
NCBI Full Gene Namecap methyltransferase 2
NCBI Gene AliasesAFT, FTSJD1, HMTr2, MTr2
ClonalityPolyclonal

Add to Compare List

United States Biological

United States Biological

4 Technology Way

Salem, Massachusetts 01970

United States

Phone: (800) 520-3011
Fax: 978-594-8052

Email: service@usbio.net
tech@usbio.net

Company Profile

Website: http://www.usbio.net

Be the First to Write a Review!